CAS Registry Number comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-08-29. Where a claim depends on a specific study, the study is described rather than over-claimed.
Analytical confirmation generally combines a separation method with a detection method. Reverse-phase high-performance liquid chromatography can assess purity, while mass spectrometry supports molecular identity. For research-grade material, a certificate of analysis may report a batch-specific purity value, but it does not guarantee biological activity or safety. Regulatory frameworks vary by country; many jurisdictions treat dihexa as a research chemical not intended for human consumption. Purchasers should verify local rules and supplier documentation. The absence of official standards makes independent testing and careful record-keeping important for laboratory work.
In laboratory settings, dihexa is typically handled as a research chemical rather than a pharmaceutical product. Suppliers may provide it as a lyophilized powder or in solution, and purity is often stated as a percentage determined by chromatographic analysis. Because independent verification is uncommon, researchers generally rely on certificates of analysis, which may include high-performance liquid chromatography and mass spectrometry data. The absence of pharmacopeial monographs means that identity, purity, and impurity profiles can vary between batches and suppliers.
Chemically, dihexa belongs to a broader group of angiotensin IV analogs. Researchers have modified the natural peptide to alter stability, binding, or distribution. Such changes can affect how the molecule behaves in experiments. The parent peptide angiotensin IV is involved in various physiological processes, but the modified analog is not identical to it. Public summaries sometimes blur the distinction between the natural fragment and the synthetic research compound. This distinction matters when interpreting study results.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical for lyophilized peptide-like research chemicals. |
| Solubility | Limited in water; soluble in some organic solvents | DMSO is commonly used for stock solutions. |
| Typical storage | -20 °C or below, desiccated, protected from light | Avoid repeated freeze-thaw cycles. |
| Purity assessment | Reverse-phase HPLC with UV detection | Mass spectrometry is often used for identity confirmation. |
| Common document | Certificate of analysis | Batch-specific; does not establish safety or efficacy. |
Dissolution depends on the peptide’s salt form, purity, and the chosen solvent. Dimethyl sulfoxide is commonly used to prepare concentrated stock solutions, while aqueous buffers may show limited solubility. Sonication or gentle warming can sometimes aid dissolution, but excessive heat may promote degradation. Once in solution, the material is generally kept cold and protected from light. Researchers should verify solubility for each lot rather than assuming uniform behavior across suppliers.
Quality control usually combines reverse-phase high-performance liquid chromatography with mass spectrometry. Chromatography estimates purity and detects related impurities, while mass spectrometry supports molecular identity. Nuclear magnetic resonance can provide additional structural confirmation when needed. Stability data for dihexa are limited, and degradation pathways may depend on pH, temperature, and moisture. Open questions include long-term stability in different formulations and the effect of repeated freeze-thaw cycles on measured purity. Such tests help confirm that a batch matches its label before use.
In laboratory settings, dihexa is typically handled as a lyophilized peptide powder. Appropriate personal protective equipment and a ventilated workspace are standard practices for weighing and transferring research chemicals. Because the compound lacks regulatory approval for clinical use, it should not be given to people. Institutional safety rules and local regulations govern its acquisition, storage, and disposal. Suppliers often provide a certificate of analysis that lists purity, identity, and batch-specific handling notes.
Reported effects of dihexa are often described in terms of synaptogenesis, a process by which neurons form new synaptic connections. This concept is biologically plausible but difficult to measure directly in living humans. Animal behavioral tests can suggest memory or learning changes, yet such tests have limitations and may not translate to people. The literature includes conflicting or incomplete findings, and some studies are small. As a result, the mechanism remains a subject of investigation rather than a settled explanation.
The proposed mechanism of dihexa involves activation of hepatocyte growth factor and its receptor, c-Met. In cell models, this signaling pathway is associated with dendritic spine formation and synaptic reorganization. Dihexa is described as a stabilized analog of angiotensin IV, which also interacts with related systems. However, the precise binding profile and downstream effects remain incompletely characterized. Most mechanistic evidence comes from in vitro assays and rodent studies rather than human trials.
Development of dihexa followed from studies on angiotensin IV analogs and their effects on learning and memory. Researchers sought compounds with improved metabolic stability and brain penetration compared with natural peptides. In preclinical reports, dihexa was associated with changes in synaptic connectivity and performance on spatial tasks. These findings generated interest in its potential as a cognitive research tool. The work remains largely preclinical, and independent replication has been limited.
Regulatory and commercial contexts differ from clinical medicine. Dihexa is not approved as a drug by major agencies, and no published human trials establish its safety or efficacy. It is often sold as a research chemical labeled for laboratory use only. Suppliers may provide certificates of analysis, but purity and identity depend on the specific batch. Legal status varies by country and may treat such compounds as unapproved substances for human consumption.
==== Eyes ==== The eye can be directly affected in the form of episcleritis or scleritis, which, when severe, can very rarely progress to perforating scleromalacia. Rather more common is the indirect effect of keratoconjunctivitis sicca, which is a dryness of eyes and mouth caused by lymphocyte infiltration of lacrimal and salivary glands. When severe, dryness of the cornea can lead to keratitis and loss of vision, as well as being painful. Preventive treatment of severe dryness with measures such as nasolacrimal duct blockage is important.
=== Flow check === A flow check is a check valve used in hydronic heating and cooling systems to prevent unwanted passive gravity flow. A flow check is a simple flow lifted gravity closed heavy metal stopper designed for low flow resistance, many decades of continuous service, and to self-clean the fine particulates commonly found in hydronic systems from the sealing surfaces. To accomplish self cleaning, the stopper is typically not conical. A circular recess in a weight that fits over a matching narrow ridge at the rim of an orifice is a common design. The application inherently tolerates a modest reverse leakage rate, a perfect seal is not required. A flow check has an operating screw to allow the valve to be held open, the opposite of the control on a stop-check valve, as an aide for filling the system and for purging air from the system.
The term bioorthogonal chemistry refers to any chemical reaction that can occur inside of living systems without interfering with native biochemical processes. The term was coined by Carolyn R. Bertozzi in 2003. Since its introduction, the concept of the bioorthogonal reaction has enabled the study of biomolecules such as glycans, proteins, and lipids in real time in living systems without cellular toxicity. A number of chemical ligation strategies have been developed that fulfill the requirements of bioorthogonality, including the 1,3-dipolar cycloaddition between azides and cyclooctynes (also termed copper-free click chemistry), between nitrones and cyclooctynes, oxime/hydrazone formation from aldehydes and ketones, the tetrazine ligation, the isocyanide-based click reaction, and most recently, the quadricyclane ligation.
It will however, place its current focus on following the sale, to operate its other retail businesses in Singapore, primarily focusing on 7-Eleven (convenience stores) and Guardian (health and beauty stores).
=== Skin cancers === MCH has been identified in both melanoma and squamous cell carcinoma cell lines. However, pro-MCH, a precursor to MCH, has not been found in melanocytes, keratinocytes, or fibroblasts, which might indicate MCH might be brought into these cells by macrophages as part of the immune response. More research is needed to fully determine and understand any relationship between MCH and possible immune responses in skin.
Sources: en.wikipedia.org
curves to cross over at different points, as illustrated. In this case, morph B crystals are energetically favored when small, but for a large enough crystal, morph A is energetically favored. This means that during crystallization, morph B tends to appear first, which then may grow without bound—that is, morph B is kinetically favored. However, it is a metastable crystal. If a seed crystal of morph A above the crossover radius
Commonly fluorophores (such as rhodamine or fluorescein) are linked to the ring linked to the sugar (in para) via a flexible arm, presumably extruding from the major groove of the helix. Due to low processivity of the nucleotides linked to bulky adducts such as fluorophores by Taq polymerases, the sequence is typically copied using a nucleotide with an arm and later coupled with a reactive fluorophore (indirect labelling):
Misuse by injection or use in the nose still occurs, and more recently the efficacy of naloxone in preventing misuse by injection has been brought into question and preparations including naloxone could even be less safe than preparations containing solely buprenorphine. Rates of misuse in the U.S. appear to be lower than with other opioids. The combination formulation was approved for medical use in the US in 2002, and in the European Union in 2017. A generic version was approved in the US in 2018. In 2019, it was the 272nd most commonly prescribed medication in the US, with more than 1 million prescriptions.
For non-small cell lung cancer, pembrolizumab is used in combination with chemotherapy (for all PD-L1, a PD-1 receptor ligand, levels) or by itself as a first-line treatment if the cancer expresses (≥ 1%) PD-L1 and the cancer has no mutations in EGFR or in ALK; if chemotherapy has already been administered, then pembrolizumab can be used as a second-line treatment, but if the cancer has EGFR or ALK mutations, agents targeting those mutations should be used first. Assessment of PD-L1 expression must be conducted with a validated and approved companion diagnostic.
Sources: en.wikipedia.org
The shells of green sea turtles and loggerhead sea turtles have been found in white shark stomachs in the Mediterranean, and bites have been recorded on leatherback sea turtles off central California. Around Seal Island, South Africa, white sharks are recorded to attack and kill seabirds like Cape cormorants, white-breasted cormorants, kelp gulls, Cape gannets, brown skuas, sooty shearwaters, and African penguins but rarely consume them.
=== Synthetic enzymes === Regardless of the details, an outstanding issue is that the physiological route of NAADP synthesis has still not been unequivocally identified — neither the reaction(s) nor the enzyme(s). Clearly, it is theoretically possible there may be multiple routes of synthesis, but this would be unprecedented in the second messenger world. To date, the most favoured hypothesis is the so-called base-exchange reaction (nicotinic acid + NADP → NAADP + nicotinamide; catalyzed by ADP-ribosyl cyclases) which are a family of enzymes that include CD38 and CD157 in mammals (and orthologs in sea urchin and Aplysia ovotestis). These were first discovered as the synthetic enzymes for cADPR but later revealed to be multifunctional, promiscuous enzymes that can also produce NAADP. Certainly NAADP production can occur in vitro but whether it occurs in vivo is another question (because genetic knockout or knock-down of ADP-ribosyl cyclases has no effect on NAADP production in some cell types), and there may be other routes which require different substrates and enzymes. The SARM1 enzyme also catalyzes the formation of NAADP from NAD+. The first chemical synthesis of NAADP was achieved in 2004 using a chemoenzymatic approach: a total chemical synthesis of NADP and then conversion of this to NAADP enzymatically.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
At a temperature below the boiling point, any matter in liquid form will evaporate until reaching equilibrium with the reverse process of condensation of its vapor. At this point the vapor will condense at the same rate as the liquid evaporates. Thus, a liquid cannot exist permanently if the evaporated liquid is continually removed. A liquid at or above its boiling point will normally boil, though superheating can prevent this in certain circumstances. At a temperature below the freezing point, a liquid will tend to crystallize, changing to its solid form. Unlike the transition to gas, there is no equilibrium at this transition under constant pressure, so unless supercooling occurs, the liquid will eventually completely crystallize. However, this is only true under constant pressure, so that (for example) water and ice in a closed, strong container might reach an equilibrium where both phases coexist. For the opposite transition from solid to liquid, see melting. The phase diagram explains why liquids do not exist in space or any other vacuum. Since the pressure is essentially zero (except on surfaces or interiors of planets and moons) water and other liquids exposed to space will either immediately boil or freeze depending on the temperature. In regions of space near the Earth, water will freeze if the sun is not shining directly on it and vaporize (sublime) as soon as it is in sunlight. If water exists as ice on the Moon, it can only exist in shadowed holes where the sun never shines and where the surrounding rock does not heat it up too much.
=== Oxygen and small molecule dependent degrons === The presence of oxygen or other small molecules can influence degron recognition. The von Hippel-Lindau (VHL) protein (substrate recognition part of a specific E3 ligase), for instance, recognizes the hypoxia-inducible factor alpha (HIF-α) only under normal oxygen conditions, when its proline is hydroxylated. Under hypoxia, on the other hand, HIF-a is not hydroxylated, evades ubiquitination and thus operates in the cell at higher concentrations which can initiate transcriptional response to hypoxia. Another example of small molecule control of protein degradation is phytohormone auxin in plants. Auxin binds to TIR1 (the substrate recognition domain of SCFTIR1ubiquitin ligase) increasing the affinity of TIR1 for its substrates (transcriptional repressors: Aux/IAA), and promoting their degradation.
Sources: en.wikipedia.org
Dry powder is usually kept frozen, desiccated, and protected from light. Solutions are often aliquoted to avoid repeated freeze-thaw cycles. Specific stability data for dihexa are limited, so general peptide storage practices are commonly used.
Reverse-phase HPLC is commonly used to estimate purity, and mass spectrometry helps confirm molecular identity. Certificates of analysis may summarize these results. Independent testing can provide additional verification when standards are unavailable.
In many countries, dihexa is not approved as a medicine and is sold only for research purposes. Regulations differ by jurisdiction, and import or possession rules may apply. Buyers should confirm local legal status before obtaining it.
Dihexa is a synthetic peptide modeled on angiotensin IV. It is used in laboratory and animal research, not as an approved medicine. Human effects remain poorly characterized.